PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g20810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 735aa    MW: 80878.4 Da    PI: 6.5074
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g20810genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.23.4e-193181656
                S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox  6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                ++t++q++ Le++F+++++p++++r +L++ lgL  rq+k+WFqNrR++ k
  CA06g20810 31 RHTAHQIQSLEAVFKECPHPDEKTRLQLSRDLGLAPRQIKFWFQNRRTQLK 81
                689********************************************9987 PP

2START167.59.1e-532224472206
                 HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEEC CS
       START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevis 86 
                 +a  a++el+++ + +ep+W+ks       +n d++ q+f+++++       ++ea+r+sgvv+m+   lv  ++d++ +W e ++    ka tlevis
  CA06g20810 222 IAGNAMEELIRLLQTNEPLWTKSTtdgrHVLNVDTYDQIFPKANSslknpnVRVEASRESGVVIMNGLALVDMFIDVN-KWAEFFPtivsKAGTLEVIS 319
                 67899********************99999***********9999*********************************.******************** PP

                 TT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX. CS
       START  87 sg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlp. 177
                  g      ++lqlm+ e q+lsplvp R  +f+R+++q + g+w+ivdvS d +q++   +s+ ++++lpSg+li++++ng+skvtw+ehv+++++   
  CA06g20810 320 CGimdsrsSTLQLMYEEQQVLSPLVPtRHLYFLRFCQQIEPGSWAIVDVSYDITQENLYPPSSCKVHKLPSGCLIQDMPNGYSKVTWLEHVEVEEKGSi 418
                 ********************************************************97799********************************998666 PP

                 HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
       START 178 hwllrslvksglaegaktwvatlqrqcek 206
                 h l+r l++sg+a+ga +w+  lqr ce+
  CA06g20810 419 HRLYRDLIHSGMAFGAERWLGSLQRMCER 447
                 ***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.17E-181283IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-202290IPR009057Homeodomain-like
SMARTSM003891.7E-182387IPR001356Homeobox domain
PROSITE profilePS5007116.8112383IPR001356Homeobox domain
CDDcd000863.52E-172484No hitNo description
PfamPF000469.5E-173181IPR001356Homeobox domain
PROSITE patternPS0002705881IPR017970Homeobox, conserved site
PROSITE profilePS5084846.705212450IPR002913START domain
SuperFamilySSF559611.75E-34213447No hitNo description
CDDcd088752.62E-112216446No hitNo description
SMARTSM002341.4E-40221447IPR002913START domain
PfamPF018521.6E-44222447IPR002913START domain
Gene3DG3DSA:3.30.530.201.4E-4227257IPR023393START-like domain
Gene3DG3DSA:3.30.530.201.4E-4330445IPR023393START-like domain
SuperFamilySSF559612.89E-18468646No hitNo description
SuperFamilySSF559612.89E-18673683No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 735 aa     Download sequence    Send to blast
MEYGSTGGGA ASSSGGGDAA DAQRKKKCFH RHTAHQIQSL EAVFKECPHP DEKTRLQLSR  60
DLGLAPRQIK FWFQNRRTQL KSQHERADNS ALRSENDRIR CENIAMREAI KNVICPSCGG  120
PPVEHTYFDE QKLRMENLQL KEELDKISSI AAKYMGRPIA QLPPVQPVHL SSLNLMSMSN  180
FGLPGPSLDL DLLPGSSTST VPSLTFPTLN ISDMDKSLMA DIAGNAMEEL IRLLQTNEPL  240
WTKSTTDGRH VLNVDTYDQI FPKANSSLKN PNVRVEASRE SGVVIMNGLA LVDMFIDVNK  300
WAEFFPTIVS KAGTLEVISC GIMDSRSSTL QLMYEEQQVL SPLVPTRHLY FLRFCQQIEP  360
GSWAIVDVSY DITQENLYPP SSCKVHKLPS GCLIQDMPNG YSKVTWLEHV EVEEKGSIHR  420
LYRDLIHSGM AFGAERWLGS LQRMCERDAC LMVSGNSSRE LGGVIPSPEG KKSMMKVSQR  480
MVSSFCASIN PSNGHQWNNI STTNEFEVRA TLQKCTDPGQ PNGVVISAAS TIWLPVPPQH  540
VFNFLRDERT RSQWDVLSNQ NPVQEVAHIA NGSHPGNSIS VLRAYNTSQN NMLILQESCI  600
DSSGSLVVYS PVDLQSINIA MSGEDTTYIP LLPSGFTILR DGRHDGGSNE ASMNNNNDTM  660
GEHNRTGGGR GGGSLVTVAF QILVSSLSSS AKMSPESVNT VNNLIGNTIH QIKAALNCSN  720
FEFNSAAALN TEYR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755181e-161HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016578176.10.0PREDICTED: homeobox-leucine zipper protein ROC8-like
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLK4C8V10.0K4C8V1_SOLLC; Uncharacterized protein
STRINGSolyc06g072310.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24902351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11